Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1683754..1684366 | Replicon | chromosome |
Accession | NZ_LS483356 | ||
Organism | Streptococcus pyogenes strain NCTC8230 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQM51_RS08930 | Protein ID | WP_111713386.1 |
Coordinates | 1684031..1684366 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQM51_RS08925 | Protein ID | WP_002988079.1 |
Coordinates | 1683754..1684041 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM51_RS08900 | 1678943..1679926 | - | 984 | WP_002982755.1 | tagatose-bisphosphate aldolase | - |
DQM51_RS08905 | 1679930..1680859 | - | 930 | WP_002982751.1 | tagatose-6-phosphate kinase | - |
DQM51_RS08910 | 1680907..1681422 | - | 516 | WP_111713385.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQM51_RS08915 | 1681457..1681885 | - | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQM51_RS08920 | 1682331..1683104 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM51_RS08925 | 1683754..1684041 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQM51_RS08930 | 1684031..1684366 | + | 336 | WP_111713386.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM51_RS08935 | 1684455..1685499 | + | 1045 | Protein_1658 | site-specific integrase | - |
DQM51_RS08945 | 1685631..1686023 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQM51_RS08950 | 1686044..1686490 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQM51_RS08955 | 1686677..1687654 | - | 978 | WP_038433791.1 | IS30-like element IS1239 family transposase | - |
DQM51_RS08960 | 1687794..1688000 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQM51_RS08965 | 1687997..1688503 | - | 507 | WP_002988070.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1686677..1687654 | 977 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13045.77 Da Isoelectric Point: 5.6658
>T292416 WP_111713386.1 NZ_LS483356:1684031-1684366 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGGENRVAIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGGENRVAIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|