Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1513830..1514442 | Replicon | chromosome |
| Accession | NZ_LS483355 | ||
| Organism | Streptococcus pyogenes strain NCTC12067 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | DQL02_RS07720 | Protein ID | WP_002994716.1 |
| Coordinates | 1514107..1514442 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQL02_RS07715 | Protein ID | WP_002988079.1 |
| Coordinates | 1513830..1514117 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL02_RS07690 | 1509009..1509992 | - | 984 | WP_031488719.1 | tagatose-bisphosphate aldolase | - |
| DQL02_RS07695 | 1509996..1510925 | - | 930 | WP_031488720.1 | tagatose-6-phosphate kinase | - |
| DQL02_RS07700 | 1510973..1511488 | - | 516 | WP_002991700.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQL02_RS07705 | 1511523..1511951 | - | 429 | WP_014635709.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQL02_RS07710 | 1512396..1513169 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQL02_RS07715 | 1513830..1514117 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQL02_RS07720 | 1514107..1514442 | + | 336 | WP_002994716.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL02_RS08945 | 1514594..1515064 | + | 471 | WP_021733374.1 | site-specific integrase | - |
| DQL02_RS08950 | 1515027..1515575 | + | 549 | WP_180372715.1 | site-specific integrase | - |
| DQL02_RS07735 | 1515707..1516099 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQL02_RS07740 | 1516120..1516566 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQL02_RS07745 | 1516784..1516990 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| DQL02_RS07750 | 1516987..1517493 | - | 507 | WP_002988070.1 | hypothetical protein | - |
| DQL02_RS07755 | 1517629..1518489 | - | 861 | WP_011529009.1 | DegV family protein | - |
| DQL02_RS07760 | 1518586..1519104 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13154.89 Da Isoelectric Point: 5.6157
>T292415 WP_002994716.1 NZ_LS483355:1514107-1514442 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|