Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 844902..845385 | Replicon | chromosome |
Accession | NZ_LS483354 | ||
Organism | Streptococcus equi subsp. zooepidemicus strain NCTC11606 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B4U2C0 |
Locus tag | DQL13_RS04055 | Protein ID | WP_012515411.1 |
Coordinates | 845125..845385 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B4U2B9 |
Locus tag | DQL13_RS04050 | Protein ID | WP_012515410.1 |
Coordinates | 844902..845123 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL13_RS04025 | 841428..841703 | + | 276 | WP_012515407.1 | hypothetical protein | - |
DQL13_RS04030 | 841887..842342 | - | 456 | WP_041785400.1 | DUF1694 domain-containing protein | - |
DQL13_RS04035 | 842574..843881 | + | 1308 | WP_012515409.1 | phosphopyruvate hydratase | - |
DQL13_RS04040 | 844120..844209 | + | 90 | WP_111677961.1 | type I toxin-antitoxin system Fst family toxin | - |
DQL13_RS04045 | 844456..844692 | - | 237 | Protein_750 | transposase | - |
DQL13_RS04050 | 844902..845123 | + | 222 | WP_012515410.1 | hypothetical protein | Antitoxin |
DQL13_RS04055 | 845125..845385 | + | 261 | WP_012515411.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL13_RS04060 | 845465..846441 | + | 977 | Protein_753 | IS3 family transposase | - |
DQL13_RS09915 | 846442..846696 | + | 255 | Protein_754 | HAD family hydrolase | - |
DQL13_RS04070 | 847166..849946 | + | 2781 | WP_012515415.1 | endonuclease/exonuclease/phosphatase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10275.81 Da Isoelectric Point: 9.8428
>T292414 WP_012515411.1 NZ_LS483354:845125-845385 [Streptococcus equi subsp. zooepidemicus]
MYRIEYSKKAQKQIKKVDKQIQRLLFAWIDKYLEGTDNPRANGKGLAGNHANEWRYRIGDYRLICDIQDDKMVVLALEFG
HRRDVY
MYRIEYSKKAQKQIKKVDKQIQRLLFAWIDKYLEGTDNPRANGKGLAGNHANEWRYRIGDYRLICDIQDDKMVVLALEFG
HRRDVY
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | B4U2C0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A380KCN4 |