Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1535785..1536397 | Replicon | chromosome |
| Accession | NZ_LS483353 | ||
| Organism | Streptococcus pyogenes strain NCTC4001 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | DQL39_RS07900 | Protein ID | WP_038433710.1 |
| Coordinates | 1536062..1536397 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQL39_RS07895 | Protein ID | WP_002988079.1 |
| Coordinates | 1535785..1536072 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL39_RS07870 | 1530976..1531959 | - | 984 | WP_038433707.1 | tagatose-bisphosphate aldolase | - |
| DQL39_RS07875 | 1531963..1532892 | - | 930 | WP_038433708.1 | tagatose-6-phosphate kinase | - |
| DQL39_RS07880 | 1532938..1533453 | - | 516 | WP_038433709.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQL39_RS07885 | 1533488..1533916 | - | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQL39_RS07890 | 1534362..1535135 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQL39_RS07895 | 1535785..1536072 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQL39_RS07900 | 1536062..1536397 | + | 336 | WP_038433710.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL39_RS09085 | 1536549..1537019 | + | 471 | WP_030127322.1 | site-specific integrase | - |
| DQL39_RS09090 | 1536982..1537530 | + | 549 | WP_193789119.1 | site-specific integrase | - |
| DQL39_RS07915 | 1537662..1538054 | - | 393 | WP_038433711.1 | 30S ribosomal protein S9 | - |
| DQL39_RS07920 | 1538075..1538521 | - | 447 | WP_011018228.1 | 50S ribosomal protein L13 | - |
| DQL39_RS07925 | 1538739..1538945 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| DQL39_RS07930 | 1538942..1539640 | - | 699 | WP_011018229.1 | hypothetical protein | - |
| DQL39_RS07935 | 1539776..1540636 | - | 861 | WP_002982687.1 | DegV family protein | - |
| DQL39_RS07940 | 1540733..1541251 | - | 519 | WP_011889154.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13144.86 Da Isoelectric Point: 5.2144
>T292413 WP_038433710.1 NZ_LS483353:1536062-1536397 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQNDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQNDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|