Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1596561..1597173 | Replicon | chromosome |
Accession | NZ_LS483352 | ||
Organism | Streptococcus pyogenes strain NCTC12052 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQL37_RS08325 | Protein ID | WP_002994716.1 |
Coordinates | 1596838..1597173 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQL37_RS08320 | Protein ID | WP_002988079.1 |
Coordinates | 1596561..1596848 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL37_RS08295 | 1591752..1592735 | - | 984 | WP_011529001.1 | tagatose-bisphosphate aldolase | - |
DQL37_RS08300 | 1592739..1593668 | - | 930 | WP_020837785.1 | tagatose-6-phosphate kinase | - |
DQL37_RS08305 | 1593714..1594229 | - | 516 | WP_002991700.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQL37_RS08310 | 1594264..1594692 | - | 429 | WP_002991702.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQL37_RS08315 | 1595138..1595911 | + | 774 | WP_111685817.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQL37_RS08320 | 1596561..1596848 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQL37_RS08325 | 1596838..1597173 | + | 336 | WP_002994716.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL37_RS09790 | 1597325..1597795 | + | 471 | Protein_1548 | tyrosine-type recombinase/integrase family protein | - |
DQL37_RS09795 | 1598157..1598306 | + | 150 | WP_011285175.1 | integrase | - |
DQL37_RS08350 | 1598438..1598830 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQL37_RS08355 | 1598851..1599297 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQL37_RS08360 | 1599515..1599721 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQL37_RS08365 | 1599718..1600224 | - | 507 | WP_002988070.1 | hypothetical protein | - |
DQL37_RS08370 | 1600360..1601220 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQL37_RS08375 | 1601317..1601835 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13154.89 Da Isoelectric Point: 5.6157
>T292412 WP_002994716.1 NZ_LS483352:1596838-1597173 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|