Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1664226..1664838 | Replicon | chromosome |
| Accession | NZ_LS483351 | ||
| Organism | Streptococcus pyogenes strain NCTC8195 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A4Z2JY48 |
| Locus tag | DQM42_RS08810 | Protein ID | WP_002982731.1 |
| Coordinates | 1664503..1664838 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQM42_RS08805 | Protein ID | WP_002988079.1 |
| Coordinates | 1664226..1664513 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM42_RS08780 | 1659415..1660398 | - | 984 | WP_002982755.1 | tagatose-bisphosphate aldolase | - |
| DQM42_RS08785 | 1660402..1661331 | - | 930 | WP_002982751.1 | tagatose-6-phosphate kinase | - |
| DQM42_RS08790 | 1661379..1661894 | - | 516 | WP_002982748.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQM42_RS08795 | 1661929..1662357 | - | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQM42_RS08800 | 1662803..1663576 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQM42_RS08805 | 1664226..1664513 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQM42_RS08810 | 1664503..1664838 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM42_RS08815 | 1664927..1665959 | + | 1033 | Protein_1634 | site-specific integrase | - |
| DQM42_RS08820 | 1666078..1666470 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQM42_RS08825 | 1666491..1666937 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQM42_RS08830 | 1667230..1668213 | + | 984 | WP_111680899.1 | IS30-like element IS1239 family transposase | - |
| DQM42_RS08835 | 1668241..1668447 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| DQM42_RS08840 | 1668444..1668950 | - | 507 | WP_002988070.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292411 WP_002982731.1 NZ_LS483351:1664503-1664838 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Z2JY48 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |