292398

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 861496..862001 Replicon chromosome
Accession NZ_LS483350
Organism Staphylococcus aureus strain NCTC11940

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag DQM92_RS04345 Protein ID WP_001103946.1
Coordinates 861708..862001 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag DQM92_RS04340 Protein ID WP_001058492.1
Coordinates 861496..861705 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM92_RS04305 857013..858233 - 1221 WP_000264182.1 site-specific integrase -
DQM92_RS04310 858321..859049 - 729 WP_000733773.1 staphylococcal enterotoxin type K -
DQM92_RS04315 859073..859801 - 729 WP_001033317.1 staphylococcal enterotoxin type Q -
DQM92_RS04320 859976..860710 - 735 WP_000142630.1 helix-turn-helix domain-containing protein -
DQM92_RS04325 860860..861072 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
DQM92_RS04330 861073..861345 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
DQM92_RS04335 861357..861503 + 147 WP_000784885.1 hypothetical protein -
DQM92_RS04340 861496..861705 + 210 WP_001058492.1 hypothetical protein Antitoxin
DQM92_RS04345 861708..862001 + 294 WP_001103946.1 DUF1474 family protein Toxin
DQM92_RS04350 862089..862958 + 870 WP_001002692.1 primase alpha helix C-terminal domain-containing protein -
DQM92_RS04355 862975..864432 + 1458 WP_000432707.1 virulence-associated E family protein -
DQM92_RS04360 864734..865096 + 363 WP_001039172.1 hypothetical protein -
DQM92_RS04365 865098..865382 + 285 WP_000998180.1 hypothetical protein -
DQM92_RS04370 865379..866020 + 642 WP_001019783.1 hypothetical protein -
DQM92_RS04375 866469..866810 + 342 WP_001190616.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage ant(9)-Ia / erm(A) selk / selq 840597..869124 28527


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T292398 WP_001103946.1 NZ_LS483350:861708-862001 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT292398 WP_001058492.1 NZ_LS483350:861496-861705 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References