Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 741130..741716 | Replicon | chromosome |
Accession | NZ_LS483349 | ||
Organism | Streptococcus mutans strain NCTC10449 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | DQM59_RS03925 | Protein ID | WP_002265423.1 |
Coordinates | 741130..741321 (+) | Length | 64 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0H5AQZ7 |
Locus tag | DQM59_RS03930 | Protein ID | WP_002269450.1 |
Coordinates | 741339..741716 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM59_RS03910 | 739174..740040 | + | 867 | WP_002280231.1 | type II CRISPR-associated endonuclease Cas1 | - |
DQM59_RS03915 | 740037..740381 | + | 345 | WP_002263547.1 | CRISPR-associated endonuclease Cas2 | - |
DQM59_RS03920 | 740371..741033 | + | 663 | WP_002263546.1 | type II-A CRISPR-associated protein Csn2 | - |
DQM59_RS03925 | 741130..741321 | + | 192 | WP_002265423.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
DQM59_RS03930 | 741339..741716 | + | 378 | WP_002269450.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
DQM59_RS03935 | 741814..742107 | - | 294 | WP_142366348.1 | hypothetical protein | - |
DQM59_RS03940 | 742186..743079 | - | 894 | WP_002272311.1 | LexA family transcriptional regulator IrvR | - |
DQM59_RS03945 | 743395..743679 | + | 285 | WP_002262720.1 | helix-turn-helix transcriptional regulator | - |
DQM59_RS03950 | 743842..745593 | + | 1752 | WP_002279994.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 64 a.a. Molecular weight: 7177.52 Da Isoelectric Point: 10.7089
>T292396 WP_002265423.1 NZ_LS483349:741130-741321 [Streptococcus mutans]
MPLTGKELARLAINNGWEEVRVRGSHHHFKKDGVPYIVTIPIHGNKVLKIGLEKKLLRDLNLL
MPLTGKELARLAINNGWEEVRVRGSHHHFKKDGVPYIVTIPIHGNKVLKIGLEKKLLRDLNLL
Download Length: 192 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14293.28 Da Isoelectric Point: 4.5628
>AT292396 WP_002269450.1 NZ_LS483349:741339-741716 [Streptococcus mutans]
MLKSYPAIFHKEEEGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGMKLPNPSEIRKLSVEDGFATMIQADP
NPYLKNNKAIRKNVTVPEWLVQLADRDQVNYSEVLTKALEKKLQL
MLKSYPAIFHKEEEGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGMKLPNPSEIRKLSVEDGFATMIQADP
NPYLKNNKAIRKNVTVPEWLVQLADRDQVNYSEVLTKALEKKLQL
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|