Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 200446..201017 | Replicon | chromosome |
Accession | NZ_LS483349 | ||
Organism | Streptococcus mutans strain NCTC10449 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2J9QC66 |
Locus tag | DQM59_RS01075 | Protein ID | WP_002265705.1 |
Coordinates | 200685..201017 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q8DW96 |
Locus tag | DQM59_RS01070 | Protein ID | WP_002262990.1 |
Coordinates | 200446..200691 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM59_RS01060 | 196353..198260 | + | 1908 | WP_002280063.1 | ATP-binding protein | - |
DQM59_RS01065 | 198280..199878 | + | 1599 | WP_002280062.1 | Abi family protein | - |
DQM59_RS01070 | 200446..200691 | + | 246 | WP_002262990.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
DQM59_RS01075 | 200685..201017 | + | 333 | WP_002265705.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQM59_RS01080 | 201215..202006 | - | 792 | WP_002280060.1 | nucleotidyltransferase domain-containing protein | - |
DQM59_RS10350 | 202173..202529 | + | 357 | Protein_182 | transposase family protein | - |
DQM59_RS01090 | 202708..203928 | + | 1221 | WP_002270688.1 | PTS sugar transporter subunit IIC | - |
DQM59_RS01095 | 203906..204754 | + | 849 | WP_002280395.1 | alpha/beta hydrolase | - |
DQM59_RS01100 | 204896..205498 | + | 603 | WP_002280396.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 202173..202301 | 128 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12664.56 Da Isoelectric Point: 6.4634
>T292395 WP_002265705.1 NZ_LS483349:200685-201017 [Streptococcus mutans]
MVTIKQGSIIKINLDPKQGHEQKGYRPYICLNHSIVTKYSNIAIFAPISNTKRDYPFYVPLEGTESTGKVLLDQLVTIDF
NARDYRYVEDIQEDLLDELLARVKVLFEKG
MVTIKQGSIIKINLDPKQGHEQKGYRPYICLNHSIVTKYSNIAIFAPISNTKRDYPFYVPLEGTESTGKVLLDQLVTIDF
NARDYRYVEDIQEDLLDELLARVKVLFEKG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9QC66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q8DW96 |