Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | SmuAT/- |
| Location | 169217..170178 | Replicon | chromosome |
| Accession | NZ_LS483349 | ||
| Organism | Streptococcus mutans strain NCTC10449 | ||
Toxin (Protein)
| Gene name | smuT | Uniprot ID | A0A2J9QC39 |
| Locus tag | DQM59_RS00870 | Protein ID | WP_002267097.1 |
| Coordinates | 169217..169732 (+) | Length | 172 a.a. |
Antitoxin (Protein)
| Gene name | smuA | Uniprot ID | - |
| Locus tag | DQM59_RS00875 | Protein ID | WP_002267098.1 |
| Coordinates | 169732..170178 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM59_RS00845 | 164634..165371 | + | 738 | WP_002273490.1 | MerR family transcriptional regulator | - |
| DQM59_RS00850 | 165407..166399 | - | 993 | WP_002280090.1 | BtrH N-terminal domain-containing protein | - |
| DQM59_RS00855 | 166588..167142 | - | 555 | Protein_138 | helix-turn-helix transcriptional regulator | - |
| DQM59_RS00860 | 167455..168201 | + | 747 | WP_002264862.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| DQM59_RS00865 | 168225..169085 | + | 861 | WP_002267096.1 | DegV family protein | - |
| DQM59_RS00870 | 169217..169732 | + | 516 | WP_002267097.1 | hypothetical protein | Toxin |
| DQM59_RS00875 | 169732..170178 | + | 447 | WP_002267098.1 | hypothetical protein | Antitoxin |
| DQM59_RS00880 | 170175..170369 | + | 195 | WP_002267099.1 | helix-turn-helix transcriptional regulator | - |
| DQM59_RS00890 | 170769..171215 | + | 447 | WP_002262993.1 | 50S ribosomal protein L13 | - |
| DQM59_RS00895 | 171240..171632 | + | 393 | WP_002262992.1 | 30S ribosomal protein S9 | - |
| DQM59_RS00900 | 171738..172961 | - | 1224 | WP_002280089.1 | tyrosine-type recombinase/integrase | - |
| DQM59_RS00905 | 173016..173288 | - | 273 | WP_002280088.1 | helix-turn-helix domain-containing protein | - |
| DQM59_RS00910 | 173400..173732 | - | 333 | WP_002280087.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DQM59_RS00915 | 173719..174024 | - | 306 | WP_002280086.1 | hypothetical protein | - |
| DQM59_RS00920 | 174081..175136 | - | 1056 | WP_002271006.1 | CHAP domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 172 a.a. Molecular weight: 19512.16 Da Isoelectric Point: 9.8653
>T292392 WP_002267097.1 NZ_LS483349:169217-169732 [Streptococcus mutans]
MFDLVVNLILLVIVIGGFVFLRFYADKKGKREYDERQLLMQKKAYTNAAWVVMGFNLVLVIWGEVLAKYISLSFAGTANL
FLIVGVFVCSSILNDAYFTARKNKKFLYVYAVIIAIQIFTVYQNWSQGSFGHDGHIYLTGEKAMSLLFILTFAVIFLVTA
YKTIQDKREGK
MFDLVVNLILLVIVIGGFVFLRFYADKKGKREYDERQLLMQKKAYTNAAWVVMGFNLVLVIWGEVLAKYISLSFAGTANL
FLIVGVFVCSSILNDAYFTARKNKKFLYVYAVIIAIQIFTVYQNWSQGSFGHDGHIYLTGEKAMSLLFILTFAVIFLVTA
YKTIQDKREGK
Download Length: 516 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 17012.29 Da Isoelectric Point: 9.5767
>AT292392 WP_002267098.1 NZ_LS483349:169732-170178 [Streptococcus mutans]
MKMEKSNKQVIYDERQQQIQLKSYSLSFWFVMFILYFATFGKTDLLLNIAFWGGLVLNFCYSTLRGVGPFVDPRFGKIAK
IGRLAAVPLIFLGMLVFLVAIIMSILEHDSLRETITKCSYLGLSGFWLICMGASIVYRHYLDKKEADK
MKMEKSNKQVIYDERQQQIQLKSYSLSFWFVMFILYFATFGKTDLLLNIAFWGGLVLNFCYSTLRGVGPFVDPRFGKIAK
IGRLAAVPLIFLGMLVFLVAIIMSILEHDSLRETITKCSYLGLSGFWLICMGASIVYRHYLDKKEADK
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|