Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1663106..1663718 | Replicon | chromosome |
Accession | NZ_LS483347 | ||
Organism | Streptococcus pyogenes strain NCTC8324 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQM50_RS08690 | Protein ID | WP_014635711.1 |
Coordinates | 1663383..1663718 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQM50_RS08685 | Protein ID | WP_002988079.1 |
Coordinates | 1663106..1663393 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM50_RS08660 | 1658297..1659280 | - | 984 | WP_014407847.1 | tagatose-bisphosphate aldolase | - |
DQM50_RS08665 | 1659284..1660213 | - | 930 | WP_085613650.1 | tagatose-6-phosphate kinase | - |
DQM50_RS08670 | 1660259..1660774 | - | 516 | WP_023612880.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQM50_RS08675 | 1660809..1661237 | - | 429 | WP_011529004.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQM50_RS08680 | 1661683..1662456 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM50_RS08685 | 1663106..1663393 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQM50_RS08690 | 1663383..1663718 | + | 336 | WP_014635711.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM50_RS10045 | 1663870..1664340 | + | 471 | WP_021733374.1 | site-specific integrase | - |
DQM50_RS10050 | 1664303..1664851 | + | 549 | WP_136115776.1 | site-specific integrase | - |
DQM50_RS08700 | 1664971..1665363 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQM50_RS08705 | 1665384..1665830 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQM50_RS08710 | 1666048..1666254 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQM50_RS08715 | 1666251..1666949 | - | 699 | WP_168390503.1 | hypothetical protein | - |
DQM50_RS08720 | 1667085..1667945 | - | 861 | WP_011529009.1 | DegV family protein | - |
DQM50_RS08725 | 1668042..1668560 | - | 519 | WP_085613648.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13173.94 Da Isoelectric Point: 5.6809
>T292391 WP_014635711.1 NZ_LS483347:1663383-1663718 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|