Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 309322..309856 | Replicon | chromosome |
Accession | NZ_LS483346 | ||
Organism | Streptococcus sanguinis strain NCTC11085 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | DQM73_RS01660 | Protein ID | WP_002926081.1 |
Coordinates | 309578..309856 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | DQM73_RS01655 | Protein ID | WP_002905395.1 |
Coordinates | 309322..309585 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM73_RS01640 | 304787..305734 | + | 948 | WP_002934498.1 | WYL domain-containing protein | - |
DQM73_RS01645 | 305984..307330 | + | 1347 | WP_002926086.1 | DUF262 domain-containing protein | - |
DQM73_RS01650 | 307324..309213 | + | 1890 | WP_002926083.1 | DUF262 domain-containing HNH endonuclease family protein | - |
DQM73_RS01655 | 309322..309585 | + | 264 | WP_002905395.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
DQM73_RS01660 | 309578..309856 | + | 279 | WP_002926081.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
DQM73_RS12315 | 309944..310096 | + | 153 | WP_002926079.1 | hypothetical protein | - |
DQM73_RS01665 | 310118..311359 | + | 1242 | WP_002926077.1 | aminopeptidase | - |
DQM73_RS01670 | 311454..311684 | + | 231 | WP_002908679.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
DQM73_RS01675 | 311746..312378 | - | 633 | WP_002926068.1 | peptide deformylase | - |
DQM73_RS01685 | 312572..313741 | + | 1170 | WP_002926066.1 | MFS transporter | - |
DQM73_RS01690 | 313753..314481 | + | 729 | WP_002926064.1 | rRNA pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 305987..319123 | 13136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 11018.96 Da Isoelectric Point: 9.7659
>T292390 WP_002926081.1 NZ_LS483346:309578-309856 [Streptococcus sanguinis]
VLKIRYHKQFKKDFKLAMKRGLKAELLEEVLEFLIQEKELPAKYRDHQLTASKHFKGVRECHVQPDWLLVYKVDKEELIL
NLLRTGSHSDLF
VLKIRYHKQFKKDFKLAMKRGLKAELLEEVLEFLIQEKELPAKYRDHQLTASKHFKGVRECHVQPDWLLVYKVDKEELIL
NLLRTGSHSDLF
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|