Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1540362..1540974 | Replicon | chromosome |
Accession | NZ_LS483345 | ||
Organism | Streptococcus pyogenes strain NCTC8231 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQL69_RS07815 | Protein ID | WP_047235979.1 |
Coordinates | 1540639..1540974 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQL69_RS07810 | Protein ID | WP_002988079.1 |
Coordinates | 1540362..1540649 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL69_RS07785 | 1535553..1536536 | - | 984 | WP_002988088.1 | tagatose-bisphosphate aldolase | - |
DQL69_RS07790 | 1536540..1537469 | - | 930 | Protein_1416 | tagatose-6-phosphate kinase | - |
DQL69_RS07795 | 1537515..1538030 | - | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQL69_RS07800 | 1538065..1538493 | - | 429 | WP_014635709.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQL69_RS07805 | 1538939..1539712 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQL69_RS07810 | 1540362..1540649 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQL69_RS07815 | 1540639..1540974 | + | 336 | WP_047235979.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL69_RS09160 | 1541126..1541596 | + | 471 | Protein_1422 | tyrosine-type recombinase/integrase family protein | - |
DQL69_RS07830 | 1541559..1542059 | + | 501 | WP_111690826.1 | site-specific integrase | - |
DQL69_RS07835 | 1542227..1542619 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQL69_RS07840 | 1542640..1543086 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQL69_RS07845 | 1543304..1543510 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQL69_RS07850 | 1543507..1544205 | - | 699 | WP_038431592.1 | hypothetical protein | - |
DQL69_RS07855 | 1544341..1545201 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQL69_RS07860 | 1545298..1545816 | - | 519 | WP_011055010.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13159.91 Da Isoelectric Point: 5.2233
>T292389 WP_047235979.1 NZ_LS483345:1540639-1540974 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFEADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFEADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|