Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 179255..179826 Replicon chromosome
Accession NZ_LS483343
Organism Streptococcus ferus strain NCTC12278

Toxin (Protein)


Gene name mazF Uniprot ID A0A2X3VI12
Locus tag DQL21_RS01060 Protein ID WP_018030834.1
Coordinates 179494..179826 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID J3AL72
Locus tag DQL21_RS01055 Protein ID WP_003089974.1
Coordinates 179255..179500 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL21_RS01025 174660..175877 - 1218 WP_018030840.1 tyrosine-type recombinase/integrase -
DQL21_RS01030 175948..176208 - 261 WP_018030839.1 helix-turn-helix domain-containing protein -
DQL21_RS01035 176267..177295 - 1029 WP_018030838.1 replication initiation factor domain-containing protein -
DQL21_RS01040 177298..177720 - 423 WP_018030837.1 hypothetical protein -
DQL21_RS01045 177999..178442 - 444 WP_018030836.1 hypothetical protein -
DQL21_RS01050 178586..179188 + 603 WP_018030835.1 helix-turn-helix domain-containing protein -
DQL21_RS01055 179255..179500 + 246 WP_003089974.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
DQL21_RS01060 179494..179826 + 333 WP_018030834.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
DQL21_RS01065 179877..180191 - 315 Protein_176 MFS transporter -
DQL21_RS01075 181335..181568 + 234 WP_018030832.1 GlsB/YeaQ/YmgE family stress response membrane protein -
DQL21_RS01080 181588..182169 + 582 WP_018030831.1 alkaline shock response membrane anchor protein AmaP -
DQL21_RS01085 182179..182361 + 183 WP_018030830.1 DUF2273 domain-containing protein -
DQL21_RS01090 182392..182913 + 522 WP_018030829.1 Asp23/Gls24 family envelope stress response protein -
DQL21_RS01095 182933..183148 + 216 WP_018030828.1 CsbD family protein -
DQL21_RS01100 183173..183709 + 537 WP_018030827.1 Asp23/Gls24 family envelope stress response protein -
DQL21_RS01105 183808..184461 + 654 WP_018030826.1 GntR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-107)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12609.57 Da        Isoelectric Point: 8.7792

>T292387 WP_018030834.1 NZ_LS483343:179494-179826 [Streptococcus ferus]
MVSIKQGSIIKINLDPKQGHEQKGYRPYICLSHSVVTKYSNLAIFAPVSNTKRDYPFYVPLRDTETTGKVLLDQLVTIDF
NARDYRYIEDVSDELLISLLARVKVLFEKG

Download         Length: 333 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9218.49 Da        Isoelectric Point: 4.6286

>AT292387 WP_003089974.1 NZ_LS483343:179255-179500 [Streptococcus ferus]
MQLTVNKWGNSSAIRLPKQLVQQLQLHTNDILDYEVSGNKIILKKATTVPELTVDDLFKDYQGEPVSVTPFIFESVGNEQ
W

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2X3VI12

Antitoxin

Source ID Structure
AlphaFold DB A0A2X3W467

References