Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1806314..1806926 | Replicon | chromosome |
| Accession | NZ_LS483342 | ||
| Organism | Streptococcus agalactiae strain NCTC11930 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8G2N8L3 |
| Locus tag | DQL56_RS09505 | Protein ID | WP_000384860.1 |
| Coordinates | 1806591..1806926 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q8E7D2 |
| Locus tag | DQL56_RS09500 | Protein ID | WP_000259017.1 |
| Coordinates | 1806314..1806601 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL56_RS09450 | 1801406..1802266 | - | 861 | WP_000477654.1 | Rgg/GadR/MutR family transcriptional regulator | - |
| DQL56_RS09470 | 1803109..1803390 | - | 282 | WP_000052406.1 | hypothetical protein | - |
| DQL56_RS09475 | 1803424..1803810 | - | 387 | WP_000259069.1 | hypothetical protein | - |
| DQL56_RS09480 | 1803795..1804475 | - | 681 | WP_001865565.1 | hypothetical protein | - |
| DQL56_RS09485 | 1804448..1805008 | - | 561 | WP_001865562.1 | hypothetical protein | - |
| DQL56_RS09490 | 1805008..1805415 | - | 408 | WP_000749954.1 | hypothetical protein | - |
| DQL56_RS09495 | 1805517..1805807 | - | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
| DQL56_RS09500 | 1806314..1806601 | + | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
| DQL56_RS09505 | 1806591..1806926 | + | 336 | WP_000384860.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL56_RS09510 | 1807231..1807701 | - | 471 | WP_000130119.1 | hypothetical protein | - |
| DQL56_RS09515 | 1807869..1809125 | - | 1257 | WP_000122836.1 | plasmid recombination protein | - |
| DQL56_RS09520 | 1809442..1809876 | - | 435 | WP_001220479.1 | hypothetical protein | - |
| DQL56_RS09525 | 1809912..1810787 | - | 876 | WP_000421240.1 | hypothetical protein | - |
| DQL56_RS09535 | 1811087..1811728 | - | 642 | WP_000591144.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13227.87 Da Isoelectric Point: 4.5348
>T292385 WP_000384860.1 NZ_LS483342:1806591-1806926 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|