Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1571102..1571714 | Replicon | chromosome |
| Accession | NZ_LS483340 | ||
| Organism | Streptococcus pyogenes strain NCTC12062 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | DQL04_RS08045 | Protein ID | WP_047235979.1 |
| Coordinates | 1571379..1571714 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQL04_RS08040 | Protein ID | WP_002988079.1 |
| Coordinates | 1571102..1571389 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL04_RS08015 | 1566293..1567276 | - | 984 | WP_002988088.1 | tagatose-bisphosphate aldolase | - |
| DQL04_RS08020 | 1567280..1568209 | - | 930 | WP_002988085.1 | tagatose-6-phosphate kinase | - |
| DQL04_RS08025 | 1568255..1568770 | - | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQL04_RS08030 | 1568805..1569233 | - | 429 | WP_014635709.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQL04_RS08035 | 1569679..1570452 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQL04_RS08040 | 1571102..1571389 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQL04_RS08045 | 1571379..1571714 | + | 336 | WP_047235979.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL04_RS09400 | 1571866..1572336 | + | 471 | Protein_1472 | tyrosine-type recombinase/integrase family protein | - |
| DQL04_RS08060 | 1572299..1572799 | + | 501 | WP_111690826.1 | site-specific integrase | - |
| DQL04_RS08065 | 1572967..1573359 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQL04_RS08070 | 1573380..1573826 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQL04_RS08075 | 1574044..1574250 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| DQL04_RS08080 | 1574247..1574945 | - | 699 | WP_038431592.1 | hypothetical protein | - |
| DQL04_RS08085 | 1575081..1575941 | - | 861 | WP_002982687.1 | DegV family protein | - |
| DQL04_RS08090 | 1576038..1576556 | - | 519 | WP_011055010.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13159.91 Da Isoelectric Point: 5.2233
>T292384 WP_047235979.1 NZ_LS483340:1571379-1571714 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFEADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFEADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|