Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1571277..1571889 | Replicon | chromosome |
Accession | NZ_LS483337 | ||
Organism | Streptococcus pyogenes strain NCTC12047 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQL03_RS08065 | Protein ID | WP_014635711.1 |
Coordinates | 1571554..1571889 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQL03_RS08060 | Protein ID | WP_002988079.1 |
Coordinates | 1571277..1571564 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL03_RS08035 | 1566467..1567450 | - | 984 | WP_014635708.1 | tagatose-bisphosphate aldolase | - |
DQL03_RS08040 | 1567454..1568383 | - | 930 | WP_063629195.1 | tagatose-6-phosphate kinase | - |
DQL03_RS08045 | 1568431..1568946 | - | 516 | WP_111675017.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQL03_RS08050 | 1568981..1569409 | - | 429 | WP_014635709.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQL03_RS08055 | 1569854..1570627 | + | 774 | WP_023605292.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQL03_RS08060 | 1571277..1571564 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQL03_RS08065 | 1571554..1571889 | + | 336 | WP_014635711.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL03_RS09270 | 1572041..1572511 | + | 471 | WP_197708796.1 | tyrosine-type recombinase/integrase family protein | - |
DQL03_RS09275 | 1572474..1573022 | + | 549 | WP_197708797.1 | site-specific integrase | - |
DQL03_RS08075 | 1573142..1573534 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQL03_RS08080 | 1573555..1574001 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQL03_RS08085 | 1574219..1574425 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQL03_RS08090 | 1574422..1574928 | - | 507 | WP_172449949.1 | hypothetical protein | - |
DQL03_RS08095 | 1575064..1575924 | - | 861 | WP_111675019.1 | DegV family protein | - |
DQL03_RS08100 | 1576021..1576539 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13173.94 Da Isoelectric Point: 5.6809
>T292382 WP_014635711.1 NZ_LS483337:1571554-1571889 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|