Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1671744..1672356 | Replicon | chromosome |
Accession | NZ_LS483335 | ||
Organism | Streptococcus pyogenes strain NCTC8332 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A4Z2JY48 |
Locus tag | DQL44_RS08825 | Protein ID | WP_002982731.1 |
Coordinates | 1672021..1672356 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A5S4TJ53 |
Locus tag | DQL44_RS08820 | Protein ID | WP_011055007.1 |
Coordinates | 1671744..1672031 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL44_RS08795 | 1666935..1667918 | - | 984 | WP_111677487.1 | tagatose-bisphosphate aldolase | - |
DQL44_RS08800 | 1667922..1668851 | - | 930 | WP_011055004.1 | tagatose-6-phosphate kinase | - |
DQL44_RS08805 | 1668897..1669412 | - | 516 | WP_011055005.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQL44_RS08810 | 1669447..1669875 | - | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQL44_RS08815 | 1670321..1671094 | + | 774 | WP_011055006.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQL44_RS08820 | 1671744..1672031 | + | 288 | WP_011055007.1 | hypothetical protein | Antitoxin |
DQL44_RS08825 | 1672021..1672356 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL44_RS10235 | 1672423..1673494 | + | 1072 | Protein_1642 | site-specific integrase | - |
DQL44_RS08845 | 1673626..1674018 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQL44_RS08850 | 1674039..1674485 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQL44_RS08855 | 1674703..1674909 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQL44_RS08860 | 1674906..1675604 | - | 699 | WP_011055008.1 | hypothetical protein | - |
DQL44_RS08865 | 1675731..1676591 | - | 861 | WP_111677489.1 | DegV family protein | - |
DQL44_RS08870 | 1676688..1677206 | - | 519 | WP_011055010.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292381 WP_002982731.1 NZ_LS483335:1672021-1672356 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Z2JY48 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5S4TJ53 |