Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1551068..1551680 | Replicon | chromosome |
| Accession | NZ_LS483333 | ||
| Organism | Streptococcus pyogenes strain NCTC12048 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | DQL30_RS07960 | Protein ID | WP_111713945.1 |
| Coordinates | 1551345..1551680 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQL30_RS07955 | Protein ID | WP_002988079.1 |
| Coordinates | 1551068..1551355 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL30_RS07930 | 1546246..1547229 | - | 984 | WP_111713943.1 | tagatose-bisphosphate aldolase | - |
| DQL30_RS07935 | 1547233..1548162 | - | 930 | WP_111713944.1 | tagatose-6-phosphate kinase | - |
| DQL30_RS07940 | 1548210..1548725 | - | 516 | WP_011285170.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQL30_RS07945 | 1548760..1549188 | - | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQL30_RS07950 | 1549634..1550407 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQL30_RS07955 | 1551068..1551355 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQL30_RS07960 | 1551345..1551680 | + | 336 | WP_111713945.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL30_RS09190 | 1551832..1552302 | + | 471 | WP_194075028.1 | site-specific integrase | - |
| DQL30_RS09195 | 1552663..1552812 | + | 150 | WP_011285175.1 | integrase | - |
| DQL30_RS07970 | 1553329..1553667 | - | 339 | WP_017285454.1 | Cd(II)/Zn(II)-sensing metalloregulatory transcriptional regulator CadX | - |
| DQL30_RS07975 | 1553679..1554305 | - | 627 | WP_170960988.1 | CadD family cadmium resistance transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13238.97 Da Isoelectric Point: 5.6809
>T292379 WP_111713945.1 NZ_LS483333:1551345-1551680 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEFRDYISQNYSSTSGQRKMEQIISDIEKLEVFREVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEFRDYISQNYSSTSGQRKMEQIISDIEKLEVFREVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|