Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1601743..1602355 | Replicon | chromosome |
| Accession | NZ_LS483332 | ||
| Organism | Streptococcus pyogenes strain NCTC12696 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | DQM36_RS08385 | Protein ID | WP_038432559.1 |
| Coordinates | 1602020..1602355 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQM36_RS08380 | Protein ID | WP_002988079.1 |
| Coordinates | 1601743..1602030 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM36_RS08355 | 1596934..1597917 | - | 984 | WP_011529001.1 | tagatose-bisphosphate aldolase | - |
| DQM36_RS08360 | 1597921..1598850 | - | 930 | WP_020837785.1 | tagatose-6-phosphate kinase | - |
| DQM36_RS08365 | 1598896..1599411 | - | 516 | WP_002991700.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQM36_RS08370 | 1599446..1599874 | - | 429 | WP_038432557.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQM36_RS08375 | 1600320..1601093 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQM36_RS08380 | 1601743..1602030 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQM36_RS08385 | 1602020..1602355 | + | 336 | WP_038432559.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQM36_RS09690 | 1602507..1602977 | + | 471 | Protein_1548 | tyrosine-type recombinase/integrase family protein | - |
| DQM36_RS09695 | 1603339..1603488 | + | 150 | WP_011285175.1 | integrase | - |
| DQM36_RS08410 | 1603620..1604012 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQM36_RS08415 | 1604033..1604479 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQM36_RS08420 | 1604697..1604903 | - | 207 | WP_038432562.1 | helix-turn-helix transcriptional regulator | - |
| DQM36_RS08425 | 1604900..1605598 | - | 699 | WP_038432565.1 | hypothetical protein | - |
| DQM36_RS08430 | 1605734..1606594 | - | 861 | WP_002982687.1 | DegV family protein | - |
| DQM36_RS08435 | 1606691..1607209 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13159.91 Da Isoelectric Point: 5.2144
>T292378 WP_038432559.1 NZ_LS483332:1602020-1602355 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIILYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIILYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|