Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1606048..1606660 | Replicon | chromosome |
| Accession | NZ_LS483331 | ||
| Organism | Streptococcus pyogenes strain NCTC12057 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A4Z2JY48 |
| Locus tag | DQL10_RS08115 | Protein ID | WP_002982731.1 |
| Coordinates | 1606325..1606660 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQL10_RS08110 | Protein ID | WP_002988079.1 |
| Coordinates | 1606048..1606335 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL10_RS08085 | 1601226..1602209 | - | 984 | WP_023611854.1 | tagatose-bisphosphate aldolase | - |
| DQL10_RS08090 | 1602213..1603142 | - | 930 | WP_023611874.1 | tagatose-6-phosphate kinase | - |
| DQL10_RS08095 | 1603190..1603705 | - | 516 | WP_014407849.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQL10_RS08100 | 1603740..1604168 | - | 429 | WP_011529004.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQL10_RS08105 | 1604614..1605387 | + | 774 | WP_002993783.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQL10_RS08110 | 1606048..1606335 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQL10_RS08115 | 1606325..1606660 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL10_RS09385 | 1606812..1607282 | + | 471 | Protein_1491 | tyrosine-type recombinase/integrase family protein | - |
| DQL10_RS09390 | 1607644..1607745 | + | 102 | WP_180372495.1 | hypothetical protein | - |
| DQL10_RS08140 | 1607925..1608317 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQL10_RS08145 | 1608338..1608784 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQL10_RS08150 | 1609002..1609208 | - | 207 | WP_023611859.1 | helix-turn-helix transcriptional regulator | - |
| DQL10_RS08155 | 1609205..1609903 | - | 699 | WP_023611871.1 | hypothetical protein | - |
| DQL10_RS08160 | 1610039..1610899 | - | 861 | WP_023611214.1 | DegV family protein | - |
| DQL10_RS08165 | 1610996..1611514 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292377 WP_002982731.1 NZ_LS483331:1606325-1606660 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Z2JY48 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |