Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1561799..1562411 | Replicon | chromosome |
Accession | NZ_LS483327 | ||
Organism | Streptococcus pyogenes strain NCTC12069 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | DQL07_RS08115 | Protein ID | WP_002994716.1 |
Coordinates | 1562076..1562411 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQL07_RS08110 | Protein ID | WP_002988079.1 |
Coordinates | 1561799..1562086 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL07_RS08085 | 1556990..1557973 | - | 984 | WP_011529001.1 | tagatose-bisphosphate aldolase | - |
DQL07_RS08090 | 1557977..1558906 | - | 930 | WP_020837785.1 | tagatose-6-phosphate kinase | - |
DQL07_RS08095 | 1558952..1559467 | - | 516 | WP_002991700.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQL07_RS08100 | 1559502..1559930 | - | 429 | WP_002991702.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQL07_RS08105 | 1560376..1561149 | + | 774 | WP_023605292.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQL07_RS08110 | 1561799..1562086 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQL07_RS08115 | 1562076..1562411 | + | 336 | WP_002994716.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL07_RS09450 | 1562563..1563033 | + | 471 | WP_021733374.1 | site-specific integrase | - |
DQL07_RS09455 | 1562996..1563544 | + | 549 | WP_136115776.1 | site-specific integrase | - |
DQL07_RS08125 | 1563664..1564056 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQL07_RS08130 | 1564077..1564523 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQL07_RS08135 | 1564741..1564947 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQL07_RS08140 | 1564944..1565642 | - | 699 | WP_023605294.1 | hypothetical protein | - |
DQL07_RS08145 | 1565778..1566638 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQL07_RS08150 | 1566735..1567253 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13154.89 Da Isoelectric Point: 5.6157
>T292375 WP_002994716.1 NZ_LS483327:1562076-1562411 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTRSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|