Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1512095..1512707 | Replicon | chromosome |
Accession | NZ_LS483326 | ||
Organism | Streptococcus pyogenes strain NCTC12045 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A4Z2JY48 |
Locus tag | DQL59_RS07670 | Protein ID | WP_002982731.1 |
Coordinates | 1512372..1512707 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQL59_RS07665 | Protein ID | WP_002988079.1 |
Coordinates | 1512095..1512382 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL59_RS07640 | 1507286..1508269 | - | 984 | WP_111681344.1 | tagatose-bisphosphate aldolase | - |
DQL59_RS07645 | 1508273..1509202 | - | 930 | WP_111681345.1 | tagatose-6-phosphate kinase | - |
DQL59_RS07650 | 1509248..1509763 | - | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQL59_RS07655 | 1509798..1510226 | - | 429 | WP_014635709.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQL59_RS07660 | 1510672..1511445 | + | 774 | WP_011285171.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQL59_RS07665 | 1512095..1512382 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQL59_RS07670 | 1512372..1512707 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL59_RS08970 | 1512859..1513329 | + | 471 | Protein_1399 | integrase | - |
DQL59_RS07685 | 1513443..1513793 | + | 351 | WP_194088838.1 | tyrosine-type recombinase/integrase | - |
DQL59_RS07690 | 1513961..1514353 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQL59_RS07695 | 1514374..1514820 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQL59_RS07700 | 1515038..1515244 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQL59_RS07705 | 1515241..1515939 | - | 699 | WP_023080151.1 | hypothetical protein | - |
DQL59_RS07710 | 1516075..1516935 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQL59_RS07715 | 1517032..1517550 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292374 WP_002982731.1 NZ_LS483326:1512372-1512707 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Z2JY48 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |