Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1512095..1512707 Replicon chromosome
Accession NZ_LS483326
Organism Streptococcus pyogenes strain NCTC12045

Toxin (Protein)


Gene name parE Uniprot ID A0A4Z2JY48
Locus tag DQL59_RS07670 Protein ID WP_002982731.1
Coordinates 1512372..1512707 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQL59_RS07665 Protein ID WP_002988079.1
Coordinates 1512095..1512382 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL59_RS07640 1507286..1508269 - 984 WP_111681344.1 tagatose-bisphosphate aldolase -
DQL59_RS07645 1508273..1509202 - 930 WP_111681345.1 tagatose-6-phosphate kinase -
DQL59_RS07650 1509248..1509763 - 516 WP_002988082.1 galactose-6-phosphate isomerase subunit LacB -
DQL59_RS07655 1509798..1510226 - 429 WP_014635709.1 galactose-6-phosphate isomerase subunit LacA -
DQL59_RS07660 1510672..1511445 + 774 WP_011285171.1 DeoR/GlpR family DNA-binding transcription regulator -
DQL59_RS07665 1512095..1512382 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQL59_RS07670 1512372..1512707 + 336 WP_002982731.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQL59_RS08970 1512859..1513329 + 471 Protein_1399 integrase -
DQL59_RS07685 1513443..1513793 + 351 WP_194088838.1 tyrosine-type recombinase/integrase -
DQL59_RS07690 1513961..1514353 - 393 WP_002982716.1 30S ribosomal protein S9 -
DQL59_RS07695 1514374..1514820 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQL59_RS07700 1515038..1515244 - 207 WP_002982695.1 helix-turn-helix transcriptional regulator -
DQL59_RS07705 1515241..1515939 - 699 WP_023080151.1 hypothetical protein -
DQL59_RS07710 1516075..1516935 - 861 WP_002982687.1 DegV family protein -
DQL59_RS07715 1517032..1517550 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13145.88 Da        Isoelectric Point: 5.2144

>T292374 WP_002982731.1 NZ_LS483326:1512372-1512707 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292374 WP_002988079.1 NZ_LS483326:1512095-1512382 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Z2JY48

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References