Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2161496..2162025 | Replicon | chromosome |
Accession | NZ_LS483324 | ||
Organism | Staphylococcus aureus strain NCTC10344 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DQL79_RS11250 | Protein ID | WP_000621175.1 |
Coordinates | 2161496..2161858 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DQL79_RS11255 | Protein ID | WP_000948331.1 |
Coordinates | 2161855..2162025 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL79_RS11225 | 2158474..2159244 | - | 771 | Protein_2072 | RNA polymerase sigma factor SigB | - |
DQL79_RS11230 | 2159219..2159698 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
DQL79_RS11235 | 2159700..2160026 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DQL79_RS11240 | 2160145..2161146 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DQL79_RS11250 | 2161496..2161858 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQL79_RS11255 | 2161855..2162025 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DQL79_RS11260 | 2162110..2163258 | - | 1149 | WP_001281154.1 | alanine racemase | - |
DQL79_RS11265 | 2163324..2163683 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
DQL79_RS11270 | 2163687..2164178 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
DQL79_RS11275 | 2164165..2165748 | - | 1584 | WP_001294620.1 | PH domain-containing protein | - |
DQL79_RS11280 | 2165741..2166220 | - | 480 | WP_001836941.1 | hypothetical protein | - |
DQL79_RS11285 | 2166429..2166989 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T292368 WP_000621175.1 NZ_LS483324:c2161858-2161496 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|