Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2107590..2108101 Replicon chromosome
Accession NZ_LS483324
Organism Staphylococcus aureus strain NCTC10344

Toxin (Protein)


Gene name TscT Uniprot ID -
Locus tag DQL79_RS10950 Protein ID WP_001103943.1
Coordinates 2107590..2107889 (-) Length 100 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag DQL79_RS10955 Protein ID WP_001058486.1
Coordinates 2107892..2108101 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL79_RS10920 2102740..2103318 - 579 WP_000846292.1 hypothetical protein -
DQL79_RS10925 2103330..2103671 - 342 WP_001161659.1 hypothetical protein -
DQL79_RS10930 2104018..2104659 - 642 WP_001836978.1 pathogenicity island protein -
DQL79_RS10935 2104661..2104933 - 273 WP_001149387.1 hypothetical protein -
DQL79_RS10940 2104920..2105723 - 804 WP_000148374.1 bifunctional DNA primase/polymerase -
DQL79_RS10945 2105899..2107515 - 1617 WP_000344761.1 hypothetical protein -
DQL79_RS10950 2107590..2107889 - 300 WP_001103943.1 DUF1474 family protein Toxin
DQL79_RS10955 2107892..2108101 - 210 WP_001058486.1 hypothetical protein Antitoxin
DQL79_RS10960 2108094..2108240 - 147 WP_000784875.1 hypothetical protein -
DQL79_RS10965 2108237..2108554 - 318 WP_000459698.1 helix-turn-helix domain-containing protein -
DQL79_RS10970 2108558..2108770 - 213 WP_000794315.1 helix-turn-helix transcriptional regulator -
DQL79_RS10975 2108944..2109576 + 633 WP_000616253.1 helix-turn-helix transcriptional regulator -
DQL79_RS10980 2109585..2110757 + 1173 WP_000179352.1 site-specific integrase -
DQL79_RS10985 2110826..2112442 - 1617 WP_000240645.1 chaperonin GroEL -
DQL79_RS10990 2112518..2112802 - 285 WP_000917289.1 co-chaperone GroES -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - scn / sak / hlb / groEL 2044270..2112802 68532


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11795.24 Da        Isoelectric Point: 4.5689

>T292367 WP_001103943.1 NZ_LS483324:c2107889-2107590 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDA

Download         Length: 300 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT292367 WP_001058486.1 NZ_LS483324:c2108101-2107892 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References