Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 899281..899758 Replicon chromosome
Accession NZ_LS483324
Organism Staphylococcus aureus strain NCTC10344

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DQL79_RS04555 Protein ID WP_000052076.1
Coordinates 899281..899469 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DQL79_RS04560 Protein ID WP_001059690.1
Coordinates 899498..899758 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL79_RS04525 895323..895793 + 471 WP_000824472.1 hypothetical protein -
DQL79_RS04530 896134..896820 + 687 WP_001548082.1 thermonuclease family protein -
DQL79_RS04535 897177..897377 + 201 WP_001059082.1 cold-shock protein -
DQL79_RS04540 897872..898090 - 219 WP_000005884.1 hypothetical protein -
DQL79_RS04545 898152..898436 - 285 WP_001004394.1 hypothetical protein -
DQL79_RS04550 898524..899093 - 570 WP_001106653.1 hypothetical protein -
DQL79_RS04555 899281..899469 - 189 WP_000052076.1 hypothetical protein Toxin
DQL79_RS04560 899498..899758 - 261 WP_001059690.1 hypothetical protein Antitoxin
DQL79_RS04565 900099..900302 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DQL79_RS04570 900299..900535 - 237 WP_000368687.1 hypothetical protein -
DQL79_RS04575 900760..901341 + 582 WP_001140697.1 phosphoglycerate mutase family protein -
DQL79_RS04580 901414..902031 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
DQL79_RS04585 902186..902680 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
DQL79_RS04590 903079..903501 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
DQL79_RS04595 903649..904365 + 717 WP_000150013.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T292362 WP_000052076.1 NZ_LS483324:c899469-899281 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT292362 WP_001059690.1 NZ_LS483324:c899758-899498 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References