Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1558252..1558864 | Replicon | chromosome |
Accession | NZ_LS483323 | ||
Organism | Streptococcus pyogenes strain NCTC8300 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q1JJZ2 |
Locus tag | DQL15_RS07945 | Protein ID | WP_002988077.1 |
Coordinates | 1558529..1558864 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQL15_RS07940 | Protein ID | WP_002988079.1 |
Coordinates | 1558252..1558539 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL15_RS07915 | 1553443..1554426 | - | 984 | WP_002988088.1 | tagatose-bisphosphate aldolase | - |
DQL15_RS07920 | 1554430..1555359 | - | 930 | WP_002988085.1 | tagatose-6-phosphate kinase | - |
DQL15_RS07925 | 1555405..1555920 | - | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQL15_RS07930 | 1555955..1556383 | - | 429 | WP_111689263.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQL15_RS07935 | 1556829..1557602 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQL15_RS07940 | 1558252..1558539 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQL15_RS07945 | 1558529..1558864 | + | 336 | WP_002988077.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL15_RS09205 | 1559016..1559486 | + | 471 | WP_002988074.1 | integrase | - |
DQL15_RS09210 | 1559449..1559811 | + | 363 | WP_180373113.1 | tyrosine-type recombinase/integrase | - |
DQL15_RS09215 | 1559847..1559996 | + | 150 | WP_002982720.1 | hypothetical protein | - |
DQL15_RS07955 | 1560116..1560508 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQL15_RS07960 | 1560529..1560975 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQL15_RS07965 | 1561193..1561399 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQL15_RS07970 | 1561396..1561902 | - | 507 | WP_002988070.1 | hypothetical protein | - |
DQL15_RS07975 | 1562038..1562898 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQL15_RS07980 | 1562995..1563513 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13117.83 Da Isoelectric Point: 5.2144
>T292361 WP_002988077.1 NZ_LS483323:1558529-1558864 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A660A236 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |