Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1497043..1497655 | Replicon | chromosome |
| Accession | NZ_LS483322 | ||
| Organism | Streptococcus pyogenes strain NCTC12066 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | DQL05_RS07625 | Protein ID | WP_023080134.1 |
| Coordinates | 1497320..1497655 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | DQL05_RS07620 | Protein ID | WP_002988079.1 |
| Coordinates | 1497043..1497330 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL05_RS07595 | 1492234..1493217 | - | 984 | WP_030126795.1 | tagatose-bisphosphate aldolase | - |
| DQL05_RS07600 | 1493221..1494150 | - | 930 | WP_030126796.1 | tagatose-6-phosphate kinase | - |
| DQL05_RS07605 | 1494196..1494711 | - | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
| DQL05_RS07610 | 1494746..1495174 | - | 429 | WP_002991702.1 | galactose-6-phosphate isomerase subunit LacA | - |
| DQL05_RS07615 | 1495620..1496393 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| DQL05_RS07620 | 1497043..1497330 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| DQL05_RS07625 | 1497320..1497655 | + | 336 | WP_023080134.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DQL05_RS08940 | 1497807..1498277 | + | 471 | Protein_1398 | integrase | - |
| DQL05_RS07640 | 1498240..1498788 | + | 549 | WP_109828874.1 | site-specific integrase | - |
| DQL05_RS07645 | 1498908..1499300 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| DQL05_RS07650 | 1499321..1499767 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| DQL05_RS07655 | 1499985..1500191 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| DQL05_RS07660 | 1500188..1500694 | - | 507 | WP_002988070.1 | hypothetical protein | - |
| DQL05_RS07665 | 1500830..1501690 | - | 861 | WP_002982687.1 | DegV family protein | - |
| DQL05_RS07670 | 1501787..1502305 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13159.91 Da Isoelectric Point: 5.2233
>T292360 WP_023080134.1 NZ_LS483322:1497320-1497655 [Streptococcus pyogenes]
MDYKKYQIIYAPEVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPEVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|