Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1614358..1614970 Replicon chromosome
Accession NZ_LS483321
Organism Streptococcus pyogenes strain NCTC8314

Toxin (Protein)


Gene name parE Uniprot ID Q5X9X8
Locus tag DQL06_RS08380 Protein ID WP_011018227.1
Coordinates 1614635..1614970 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q5X9X9
Locus tag DQL06_RS08375 Protein ID WP_002988079.1
Coordinates 1614358..1614645 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL06_RS08350 1609550..1610533 - 984 WP_030126263.1 tagatose-bisphosphate aldolase -
DQL06_RS08355 1610537..1611466 - 930 WP_111689673.1 tagatose-6-phosphate kinase -
DQL06_RS08360 1611512..1612027 - 516 WP_014407849.1 galactose-6-phosphate isomerase subunit LacB -
DQL06_RS08365 1612062..1612490 - 429 WP_011529004.1 galactose-6-phosphate isomerase subunit LacA -
DQL06_RS08370 1612936..1613709 + 774 WP_002993783.1 DeoR/GlpR family DNA-binding transcription regulator -
DQL06_RS08375 1614358..1614645 + 288 WP_002988079.1 DNA-damage-inducible protein J Antitoxin
DQL06_RS08380 1614635..1614970 + 336 WP_011018227.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQL06_RS08385 1615122..1615592 + 471 WP_030126261.1 site-specific integrase -
DQL06_RS08390 1615706..1616056 + 351 WP_194117792.1 tyrosine-type recombinase/integrase -
DQL06_RS08395 1616224..1616616 - 393 WP_030126260.1 30S ribosomal protein S9 -
DQL06_RS08400 1616637..1617083 - 447 WP_002982710.1 50S ribosomal protein L13 -
DQL06_RS08405 1617301..1617507 - 207 WP_011285176.1 helix-turn-helix transcriptional regulator -
DQL06_RS08410 1617504..1618202 - 699 WP_030126259.1 hypothetical protein -
DQL06_RS08415 1618338..1619198 - 861 WP_030127324.1 DegV family protein -
DQL06_RS08420 1619295..1619813 - 519 WP_002982682.1 NYN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-105)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 13171.97 Da        Isoelectric Point: 5.2144

>T292359 WP_011018227.1 NZ_LS483321:1614635-1614970 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK

Download         Length: 336 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10934.56 Da        Isoelectric Point: 5.2318

>AT292359 WP_002988079.1 NZ_LS483321:1614358-1614645 [Streptococcus pyogenes]
MTTVKKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVVVTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQ
GKFYTSEEVRAELGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z2QKE7

Antitoxin

Source ID Structure
AlphaFold DB A0A4U7GX94

References