Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1170035..1170811 | Replicon | chromosome |
Accession | NZ_LS483319 | ||
Organism | Staphylococcus aureus strain NCTC13140 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | DQL82_RS06175 | Protein ID | WP_000031108.1 |
Coordinates | 1170659..1170811 (+) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DQL82_RS06170 | Protein ID | WP_001251224.1 |
Coordinates | 1170035..1170634 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL82_RS06150 | 1165951..1167408 | + | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
DQL82_RS06155 | 1167401..1168123 | + | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
DQL82_RS06160 | 1168274..1169401 | + | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DQL82_RS06165 | 1169406..1169876 | + | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DQL82_RS06170 | 1170035..1170634 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DQL82_RS06175 | 1170659..1170811 | + | 153 | WP_000031108.1 | hypothetical protein | Toxin |
DQL82_RS06190 | 1171482..1172654 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
DQL82_RS06195 | 1172920..1173315 | + | 396 | WP_000901021.1 | hypothetical protein | - |
DQL82_RS06200 | 1173511..1174896 | + | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1171482..1172654 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T292344 WP_000031108.1 NZ_LS483319:1170659-1170811 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT292344 WP_001251224.1 NZ_LS483319:1170035-1170634 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|