Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2135335..2135864 | Replicon | chromosome |
Accession | NZ_LS483317 | ||
Organism | Staphylococcus aureus strain NCTC5663 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DQL75_RS10955 | Protein ID | WP_000621175.1 |
Coordinates | 2135335..2135697 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DQL75_RS10960 | Protein ID | WP_000948331.1 |
Coordinates | 2135694..2135864 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL75_RS10930 | 2132313..2133083 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
DQL75_RS10935 | 2133058..2133537 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
DQL75_RS10940 | 2133539..2133865 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DQL75_RS10945 | 2133984..2134985 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DQL75_RS10955 | 2135335..2135697 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQL75_RS10960 | 2135694..2135864 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DQL75_RS10965 | 2135949..2137097 | - | 1149 | WP_111762513.1 | alanine racemase | - |
DQL75_RS10970 | 2137163..2137522 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
DQL75_RS10975 | 2137526..2138017 | - | 492 | WP_078316666.1 | PH domain-containing protein | - |
DQL75_RS10980 | 2138004..2139587 | - | 1584 | WP_111762514.1 | PH domain-containing protein | - |
DQL75_RS10985 | 2139580..2140059 | - | 480 | WP_111762515.1 | hypothetical protein | - |
DQL75_RS10990 | 2140268..2140828 | - | 561 | WP_111762516.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T292336 WP_000621175.1 NZ_LS483317:c2135697-2135335 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|