Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 874766..875243 Replicon chromosome
Accession NZ_LS483317
Organism Staphylococcus aureus strain NCTC5663

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DQL75_RS04410 Protein ID WP_000052076.1
Coordinates 874766..874954 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DQL75_RS04415 Protein ID WP_001059690.1
Coordinates 874983..875243 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL75_RS04380 870808..871278 + 471 WP_072491423.1 hypothetical protein -
DQL75_RS04385 871619..872305 + 687 WP_111762061.1 thermonuclease family protein -
DQL75_RS04390 872662..872862 + 201 WP_001059082.1 cold-shock protein -
DQL75_RS04395 873357..873575 - 219 WP_111762062.1 hypothetical protein -
DQL75_RS04400 873637..873921 - 285 WP_001004401.1 hypothetical protein -
DQL75_RS04405 874009..874578 - 570 WP_001106648.1 hypothetical protein -
DQL75_RS04410 874766..874954 - 189 WP_000052076.1 hypothetical protein Toxin
DQL75_RS04415 874983..875243 - 261 WP_001059690.1 hypothetical protein Antitoxin
DQL75_RS04420 875584..875787 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DQL75_RS04425 875784..876020 - 237 WP_000368687.1 hypothetical protein -
DQL75_RS04430 876244..876825 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DQL75_RS04435 876898..877515 - 618 WP_000255554.1 LysE/ArgO family amino acid transporter -
DQL75_RS04440 877671..878165 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
DQL75_RS04445 878564..878986 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
DQL75_RS04450 879134..879850 + 717 WP_111762063.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T292333 WP_000052076.1 NZ_LS483317:c874954-874766 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT292333 WP_001059690.1 NZ_LS483317:c875243-874983 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References