Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1570561..1571173 | Replicon | chromosome |
Accession | NZ_LS483315 | ||
Organism | Streptococcus pyogenes strain NCTC12059 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q1JJZ2 |
Locus tag | DQL11_RS08030 | Protein ID | WP_002988077.1 |
Coordinates | 1570838..1571173 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQL11_RS08025 | Protein ID | WP_002988079.1 |
Coordinates | 1570561..1570848 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL11_RS08000 | 1565752..1566735 | - | 984 | WP_002988088.1 | tagatose-bisphosphate aldolase | - |
DQL11_RS08005 | 1566739..1567668 | - | 930 | WP_111704783.1 | tagatose-6-phosphate kinase | - |
DQL11_RS08010 | 1567714..1568229 | - | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQL11_RS08015 | 1568264..1568692 | - | 429 | WP_111704784.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQL11_RS08020 | 1569138..1569911 | + | 774 | WP_023605292.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQL11_RS08025 | 1570561..1570848 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQL11_RS08030 | 1570838..1571173 | + | 336 | WP_002988077.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQL11_RS08035 | 1571262..1572306 | + | 1045 | Protein_1471 | site-specific integrase | - |
DQL11_RS08040 | 1572426..1572818 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQL11_RS08045 | 1572839..1573285 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQL11_RS08050 | 1573503..1573709 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQL11_RS08055 | 1573706..1574212 | - | 507 | WP_172449835.1 | hypothetical protein | - |
DQL11_RS08060 | 1574348..1575208 | - | 861 | WP_002982687.1 | DegV family protein | - |
DQL11_RS08065 | 1575305..1575823 | - | 519 | WP_002982682.1 | NYN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13117.83 Da Isoelectric Point: 5.2144
>T292315 WP_002988077.1 NZ_LS483315:1570838-1571173 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A660A236 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |