Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2102107..2102636 | Replicon | chromosome |
Accession | NZ_LS483314 | ||
Organism | Staphylococcus aureus strain NCTC3761 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DQL90_RS10855 | Protein ID | WP_000621175.1 |
Coordinates | 2102107..2102469 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DQL90_RS10860 | Protein ID | WP_000948331.1 |
Coordinates | 2102466..2102636 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL90_RS10830 | 2099085..2099855 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
DQL90_RS10835 | 2099830..2100309 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
DQL90_RS10840 | 2100311..2100637 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DQL90_RS10845 | 2100756..2101757 | - | 1002 | WP_111688671.1 | PP2C family protein-serine/threonine phosphatase | - |
DQL90_RS10855 | 2102107..2102469 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQL90_RS10860 | 2102466..2102636 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DQL90_RS10865 | 2102721..2103869 | - | 1149 | WP_001281154.1 | alanine racemase | - |
DQL90_RS10870 | 2103935..2104294 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
DQL90_RS10875 | 2104298..2104789 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
DQL90_RS10880 | 2104776..2106359 | - | 1584 | WP_001294620.1 | PH domain-containing protein | - |
DQL90_RS10885 | 2106352..2106831 | - | 480 | WP_001287079.1 | hypothetical protein | - |
DQL90_RS10890 | 2107040..2107600 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T292310 WP_000621175.1 NZ_LS483314:c2102469-2102107 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|