Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 2048061..2048572 | Replicon | chromosome |
| Accession | NZ_LS483314 | ||
| Organism | Staphylococcus aureus strain NCTC3761 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | - |
| Locus tag | DQL90_RS10550 | Protein ID | WP_001103943.1 |
| Coordinates | 2048061..2048360 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | - |
| Locus tag | DQL90_RS10555 | Protein ID | WP_001058486.1 |
| Coordinates | 2048363..2048572 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL90_RS10520 | 2043211..2043789 | - | 579 | WP_000846292.1 | hypothetical protein | - |
| DQL90_RS10525 | 2043801..2044142 | - | 342 | WP_001161659.1 | hypothetical protein | - |
| DQL90_RS10530 | 2044489..2045130 | - | 642 | WP_001019765.1 | hypothetical protein | - |
| DQL90_RS10535 | 2045132..2045404 | - | 273 | WP_001149387.1 | hypothetical protein | - |
| DQL90_RS10540 | 2045391..2046194 | - | 804 | WP_000148374.1 | bifunctional DNA primase/polymerase | - |
| DQL90_RS10545 | 2046370..2047986 | - | 1617 | WP_111688665.1 | phage resistance protein | - |
| DQL90_RS10550 | 2048061..2048360 | - | 300 | WP_001103943.1 | DUF1474 family protein | Toxin |
| DQL90_RS10555 | 2048363..2048572 | - | 210 | WP_001058486.1 | hypothetical protein | Antitoxin |
| DQL90_RS10560 | 2048565..2048711 | - | 147 | WP_000784875.1 | hypothetical protein | - |
| DQL90_RS10565 | 2048708..2049025 | - | 318 | WP_000459698.1 | helix-turn-helix domain-containing protein | - |
| DQL90_RS10570 | 2049029..2049241 | - | 213 | WP_000794315.1 | helix-turn-helix transcriptional regulator | - |
| DQL90_RS10575 | 2049415..2050047 | + | 633 | WP_000616253.1 | helix-turn-helix transcriptional regulator | - |
| DQL90_RS10580 | 2050056..2051228 | + | 1173 | WP_000179352.1 | site-specific integrase | - |
| DQL90_RS10585 | 2051297..2052913 | - | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| DQL90_RS10590 | 2052989..2053273 | - | 285 | WP_000917289.1 | co-chaperone GroES | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL | 2028057..2053273 | 25216 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11795.24 Da Isoelectric Point: 4.5689
>T292309 WP_001103943.1 NZ_LS483314:c2048360-2048061 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDA
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|