Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1051213..1051727 | Replicon | chromosome |
Accession | NZ_LS483313 | ||
Organism | Staphylococcus simulans strain NCTC11046 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DQL89_RS04785 | Protein ID | WP_031262808.1 |
Coordinates | 1051377..1051727 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2T4QNU3 |
Locus tag | DQL89_RS04780 | Protein ID | WP_023016097.1 |
Coordinates | 1051213..1051380 (+) | Length | 56 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL89_RS04755 | 1047103..1047567 | + | 465 | WP_060804059.1 | PH domain-containing protein | - |
DQL89_RS04760 | 1047560..1049053 | + | 1494 | WP_070626487.1 | PH domain-containing protein | - |
DQL89_RS04765 | 1049046..1049543 | + | 498 | WP_070626486.1 | PH domain-containing protein | - |
DQL89_RS04770 | 1049545..1049898 | + | 354 | WP_070626517.1 | holo-ACP synthase | - |
DQL89_RS04775 | 1049978..1051132 | + | 1155 | WP_070626485.1 | alanine racemase | - |
DQL89_RS04780 | 1051213..1051380 | + | 168 | WP_023016097.1 | hypothetical protein | Antitoxin |
DQL89_RS04785 | 1051377..1051727 | + | 351 | WP_031262808.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQL89_RS04790 | 1052019..1053020 | + | 1002 | WP_002481750.1 | PP2C family protein-serine/threonine phosphatase | - |
DQL89_RS04795 | 1053096..1053422 | + | 327 | WP_002481749.1 | anti-sigma factor antagonist | - |
DQL89_RS04800 | 1053424..1053903 | + | 480 | WP_023016096.1 | anti-sigma B factor RsbW | - |
DQL89_RS04805 | 1053878..1054648 | + | 771 | WP_002481747.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.09 Da Isoelectric Point: 10.0474
>T292306 WP_031262808.1 NZ_LS483313:1051377-1051727 [Staphylococcus simulans]
MMRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TVDKKRLKEKLTYLSDEKMKEIDNAIGISLGLTHKN
MMRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TVDKKRLKEKLTYLSDEKMKEIDNAIGISLGLTHKN
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|