Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1111512..1112321 | Replicon | chromosome |
Accession | NZ_LS483312 | ||
Organism | Staphylococcus lugdunensis strain NCTC7990 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | DQL63_RS05340 | Protein ID | WP_002458758.1 |
Coordinates | 1112151..1112321 (+) | Length | 57 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | A0A853V5R2 |
Locus tag | DQL63_RS05335 | Protein ID | WP_002458757.1 |
Coordinates | 1111512..1112111 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL63_RS05315 | 1107106..1108563 | + | 1458 | WP_002477974.1 | ABC transporter substrate-binding protein/permease | - |
DQL63_RS05320 | 1108556..1109281 | + | 726 | WP_002458754.1 | amino acid ABC transporter ATP-binding protein | - |
DQL63_RS05325 | 1109732..1110874 | + | 1143 | WP_002458755.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DQL63_RS05330 | 1110876..1111346 | + | 471 | WP_002458756.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DQL63_RS05335 | 1111512..1112111 | + | 600 | WP_002458757.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DQL63_RS05340 | 1112151..1112321 | + | 171 | WP_002458758.1 | hypothetical protein | Toxin |
DQL63_RS05345 | 1112495..1112890 | + | 396 | WP_002458759.1 | hypothetical protein | - |
DQL63_RS05350 | 1113018..1114403 | + | 1386 | WP_002458760.1 | class II fumarate hydratase | - |
DQL63_RS05355 | 1114468..1115304 | - | 837 | WP_002458761.1 | RluA family pseudouridine synthase | - |
DQL63_RS05360 | 1115472..1116584 | + | 1113 | WP_037542869.1 | GAF domain-containing sensor histidine kinase | - |
DQL63_RS05365 | 1116606..1117229 | + | 624 | WP_002458763.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 57 a.a. Molecular weight: 6565.10 Da Isoelectric Point: 4.6723
>T292304 WP_002458758.1 NZ_LS483312:1112151-1112321 [Staphylococcus lugdunensis]
MSKEKKSRLNYHEEENAMVENLEDLKELGKEMEHISEKNDEEKVNQSHDTSKSSNS
MSKEKKSRLNYHEEENAMVENLEDLKELGKEMEHISEKNDEEKVNQSHDTSKSSNS
Download Length: 171 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22619.51 Da Isoelectric Point: 4.9539
>AT292304 WP_002458757.1 NZ_LS483312:1111512-1112111 [Staphylococcus lugdunensis]
MAMNFKVFENKDQVAEYSADIIRKQFNNNPTTIAGFHLNKEASPVLDMLKKNVDQHAVDFSQINILDYDQNQEYFKALGV
PESQIYPISYDQDAEAFISDKIKTKDNKGKLILQVASIDDQGNLNISLRQGLLNAREIILVITGHNKKEVVEKLYNENGK
SNFEPADLKAHRMVTVILDEAAAEGLPEDVRHYFTDRFA
MAMNFKVFENKDQVAEYSADIIRKQFNNNPTTIAGFHLNKEASPVLDMLKKNVDQHAVDFSQINILDYDQNQEYFKALGV
PESQIYPISYDQDAEAFISDKIKTKDNKGKLILQVASIDDQGNLNISLRQGLLNAREIILVITGHNKKEVVEKLYNENGK
SNFEPADLKAHRMVTVILDEAAAEGLPEDVRHYFTDRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|