Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 971718..972235 | Replicon | chromosome |
Accession | NZ_LS483312 | ||
Organism | Staphylococcus lugdunensis strain NCTC7990 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A853V3R6 |
Locus tag | DQL63_RS04550 | Protein ID | WP_002461192.1 |
Coordinates | 971885..972235 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A853V233 |
Locus tag | DQL63_RS04545 | Protein ID | WP_002461193.1 |
Coordinates | 971718..971888 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL63_RS04520 | 967543..968025 | + | 483 | WP_037543569.1 | PH domain-containing protein | - |
DQL63_RS04525 | 968018..969532 | + | 1515 | WP_002461198.1 | PH domain-containing protein | - |
DQL63_RS04530 | 969519..970031 | + | 513 | WP_002461197.1 | PH domain-containing protein | - |
DQL63_RS04535 | 970043..970435 | + | 393 | WP_002461196.1 | holo-ACP synthase | - |
DQL63_RS04540 | 970483..971631 | + | 1149 | WP_037543565.1 | alanine racemase | - |
DQL63_RS04545 | 971718..971888 | + | 171 | WP_002461193.1 | hypothetical protein | Antitoxin |
DQL63_RS04550 | 971885..972235 | + | 351 | WP_002461192.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQL63_RS04555 | 972669..973670 | + | 1002 | WP_111703859.1 | PP2C family protein-serine/threonine phosphatase | - |
DQL63_RS04560 | 973761..974087 | + | 327 | WP_002461190.1 | anti-sigma factor antagonist | - |
DQL63_RS04565 | 974089..974568 | + | 480 | WP_012990787.1 | anti-sigma B factor RsbW | - |
DQL63_RS04570 | 974543..975313 | + | 771 | WP_002461188.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13079.20 Da Isoelectric Point: 9.9784
>T292303 WP_002461192.1 NZ_LS483312:971885-972235 [Staphylococcus lugdunensis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIGKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSEDKMKEVDHALDISLGLHNYH
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIGKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSEDKMKEVDHALDISLGLHNYH
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A853V3R6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A853V233 |