Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2175737..2176266 | Replicon | chromosome |
| Accession | NZ_LS483311 | ||
| Organism | Staphylococcus aureus strain NCTC6136 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | DQL83_RS11485 | Protein ID | WP_000621175.1 |
| Coordinates | 2175737..2176099 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | DQL83_RS11490 | Protein ID | WP_000948331.1 |
| Coordinates | 2176096..2176266 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL83_RS11460 | 2172716..2173486 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
| DQL83_RS11465 | 2173461..2173940 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| DQL83_RS11470 | 2173942..2174268 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| DQL83_RS11475 | 2174387..2175388 | - | 1002 | WP_111724430.1 | PP2C family protein-serine/threonine phosphatase | - |
| DQL83_RS11485 | 2175737..2176099 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DQL83_RS11490 | 2176096..2176266 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| DQL83_RS11495 | 2176351..2177499 | - | 1149 | WP_001281154.1 | alanine racemase | - |
| DQL83_RS11500 | 2177565..2177924 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| DQL83_RS11505 | 2177928..2178419 | - | 492 | WP_001205917.1 | PH domain-containing protein | - |
| DQL83_RS11510 | 2178406..2179989 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| DQL83_RS11515 | 2179982..2180461 | - | 480 | WP_001287086.1 | hypothetical protein | - |
| DQL83_RS11520 | 2180670..2181230 | - | 561 | WP_001092410.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T292295 WP_000621175.1 NZ_LS483311:c2176099-2175737 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|