Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 874596..875073 Replicon chromosome
Accession NZ_LS483311
Organism Staphylococcus aureus strain NCTC6136

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DQL83_RS04525 Protein ID WP_000052076.1
Coordinates 874596..874784 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DQL83_RS04530 Protein ID WP_001059690.1
Coordinates 874813..875073 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL83_RS04495 870631..871107 + 477 WP_000824477.1 hypothetical protein -
DQL83_RS04500 871448..872134 + 687 WP_001641381.1 thermonuclease family protein -
DQL83_RS04505 872491..872691 + 201 WP_001059082.1 cold-shock protein -
DQL83_RS04510 873187..873405 - 219 WP_000005887.1 hypothetical protein -
DQL83_RS04515 873467..873751 - 285 WP_001004401.1 hypothetical protein -
DQL83_RS04520 873839..874408 - 570 WP_001106652.1 hypothetical protein -
DQL83_RS04525 874596..874784 - 189 WP_000052076.1 hypothetical protein Toxin
DQL83_RS04530 874813..875073 - 261 WP_001059690.1 hypothetical protein Antitoxin
DQL83_RS04535 875414..875617 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DQL83_RS04540 875614..875850 - 237 WP_000368687.1 hypothetical protein -
DQL83_RS04545 876075..876656 + 582 WP_001140697.1 phosphoglycerate mutase family protein -
DQL83_RS04550 876729..877346 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
DQL83_RS04555 877502..877996 - 495 WP_111724405.1 GNAT family N-acetyltransferase -
DQL83_RS04560 878395..878817 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
DQL83_RS04565 878965..879681 + 717 WP_000150016.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T292289 WP_000052076.1 NZ_LS483311:c874784-874596 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT292289 WP_001059690.1 NZ_LS483311:c875073-874813 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References