Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 408879..409390 Replicon chromosome
Accession NZ_LS483311
Organism Staphylococcus aureus strain NCTC6136

Toxin (Protein)


Gene name TscT Uniprot ID -
Locus tag DQL83_RS02075 Protein ID WP_111724374.1
Coordinates 409091..409390 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag DQL83_RS02070 Protein ID WP_001058486.1
Coordinates 408879..409088 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL83_RS02030 403941..404444 + 504 WP_000934799.1 single-stranded DNA-binding protein -
DQL83_RS02035 404496..404738 + 243 WP_000897044.1 30S ribosomal protein S18 -
DQL83_RS02040 404977..405876 - 900 WP_001797289.1 Abi family protein -
DQL83_RS02045 405878..407092 - 1215 WP_111724373.1 site-specific integrase -
DQL83_RS02050 407371..408066 - 696 WP_031903008.1 helix-turn-helix domain-containing protein -
DQL83_RS02055 408211..408423 + 213 WP_000608987.1 hypothetical protein -
DQL83_RS02060 408456..408728 + 273 WP_031903009.1 helix-turn-helix domain-containing protein -
DQL83_RS02065 408740..408886 + 147 WP_000784875.1 hypothetical protein -
DQL83_RS02070 408879..409088 + 210 WP_001058486.1 hypothetical protein Antitoxin
DQL83_RS02075 409091..409390 + 300 WP_111724374.1 DUF1474 family protein Toxin
DQL83_RS02080 409465..411081 + 1617 WP_111724375.1 phage resistance protein -
DQL83_RS02085 411257..412060 + 804 WP_111724376.1 bifunctional DNA primase/polymerase -
DQL83_RS02090 412047..412319 + 273 WP_111724377.1 pathogenicity island protein -
DQL83_RS02095 412321..412962 + 642 WP_111724378.1 pathogenicity island protein -
DQL83_RS02100 413406..413750 + 345 WP_001288441.1 hypothetical protein -
DQL83_RS02105 413785..414363 + 579 WP_031769358.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 403941..424573 20632


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11844.32 Da        Isoelectric Point: 4.5689

>T292288 WP_111724374.1 NZ_LS483311:409091-409390 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHIYFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDA

Download         Length: 300 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT292288 WP_001058486.1 NZ_LS483311:408879-409088 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References