Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 316778..317566 Replicon chromosome
Accession NZ_LS483311
Organism Staphylococcus aureus strain NCTC6136

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag DQL83_RS01465 Protein ID WP_000525004.1
Coordinates 316778..317239 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag DQL83_RS01470 Protein ID WP_000333630.1
Coordinates 317252..317566 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL83_RS01440 311833..313764 + 1932 Protein_269 YSIRK domain-containing triacylglycerol lipase Lip2/Geh -
DQL83_RS01445 313858..315063 - 1206 WP_000264743.1 site-specific integrase -
DQL83_RS01450 315189..315803 + 615 WP_000191466.1 hypothetical protein -
DQL83_RS01455 315800..315946 - 147 WP_074370993.1 hypothetical protein -
DQL83_RS01460 316176..316760 - 585 WP_000825948.1 hypothetical protein -
DQL83_RS01465 316778..317239 - 462 WP_000525004.1 hypothetical protein Toxin
DQL83_RS01470 317252..317566 - 315 WP_000333630.1 helix-turn-helix domain-containing protein Antitoxin
DQL83_RS01475 317718..317954 + 237 WP_001121027.1 helix-turn-helix domain-containing protein -
DQL83_RS01480 317968..318744 + 777 WP_111724364.1 Rha family transcriptional regulator -
DQL83_RS01485 318773..318916 + 144 WP_000939498.1 hypothetical protein -
DQL83_RS01490 318906..319115 - 210 WP_000642492.1 hypothetical protein -
DQL83_RS01495 319171..319416 + 246 WP_001025401.1 DUF2829 domain-containing protein -
DQL83_RS01500 319385..319750 - 366 WP_001128433.1 hypothetical protein -
DQL83_RS01505 319805..320020 + 216 WP_001097552.1 hypothetical protein -
DQL83_RS01510 320045..320308 + 264 WP_001124159.1 helix-turn-helix domain-containing protein -
DQL83_RS01515 320321..320482 + 162 WP_001285963.1 DUF1270 family protein -
DQL83_RS01520 320561..320884 + 324 WP_000174994.1 hypothetical protein -
DQL83_RS01525 320899..321261 + 363 WP_111724365.1 hypothetical protein -
DQL83_RS01530 321258..322424 + 1167 WP_047216521.1 DUF2800 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 313858..358468 44610


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T292285 WP_000525004.1 NZ_LS483311:c317239-316778 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT292285 WP_000333630.1 NZ_LS483311:c317566-317252 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References