Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2239877..2240406 | Replicon | chromosome |
Accession | NZ_LS483309 | ||
Organism | Staphylococcus aureus strain NCTC9944 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DQL96_RS11800 | Protein ID | WP_000621175.1 |
Coordinates | 2239877..2240239 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DQL96_RS11805 | Protein ID | WP_000948331.1 |
Coordinates | 2240236..2240406 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL96_RS11775 | 2236856..2237626 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
DQL96_RS11780 | 2237601..2238080 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
DQL96_RS11785 | 2238082..2238408 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DQL96_RS11790 | 2238527..2239528 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DQL96_RS11800 | 2239877..2240239 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQL96_RS11805 | 2240236..2240406 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DQL96_RS11810 | 2240491..2241639 | - | 1149 | WP_001281145.1 | alanine racemase | - |
DQL96_RS11815 | 2241705..2242064 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
DQL96_RS11820 | 2242068..2242559 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
DQL96_RS11825 | 2242546..2244129 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
DQL96_RS11830 | 2244122..2244601 | - | 480 | WP_001287088.1 | hypothetical protein | - |
DQL96_RS11835 | 2244809..2245369 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T292266 WP_000621175.1 NZ_LS483309:c2240239-2239877 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|