Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 2034168..2034944 | Replicon | chromosome |
Accession | NZ_LS483309 | ||
Organism | Staphylococcus aureus strain NCTC9944 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | DQL96_RS10430 | Protein ID | WP_000031108.1 |
Coordinates | 2034168..2034320 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DQL96_RS10435 | Protein ID | WP_001251224.1 |
Coordinates | 2034345..2034944 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL96_RS10410 | 2030365..2031186 | + | 822 | WP_000669375.1 | RluA family pseudouridine synthase | - |
DQL96_RS10415 | 2031649..2033034 | - | 1386 | WP_111689346.1 | class II fumarate hydratase | - |
DQL96_RS10420 | 2033230..2033625 | - | 396 | WP_000901021.1 | hypothetical protein | - |
DQL96_RS10430 | 2034168..2034320 | - | 153 | WP_000031108.1 | hypothetical protein | Toxin |
DQL96_RS10435 | 2034345..2034944 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DQL96_RS10440 | 2035103..2035573 | - | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DQL96_RS10445 | 2035578..2036705 | - | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DQL96_RS10450 | 2036856..2037578 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
DQL96_RS10455 | 2037571..2039028 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T292262 WP_000031108.1 NZ_LS483309:c2034320-2034168 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT292262 WP_001251224.1 NZ_LS483309:c2034944-2034345 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|