Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 2005390..2006178 | Replicon | chromosome |
| Accession | NZ_LS483309 | ||
| Organism | Staphylococcus aureus strain NCTC9944 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | DQL96_RS10235 | Protein ID | WP_000525015.1 |
| Coordinates | 2005717..2006178 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | DQL96_RS10230 | Protein ID | WP_000333632.1 |
| Coordinates | 2005390..2005704 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL96_RS10170 | 2000657..2000917 | - | 261 | WP_000291075.1 | DUF1108 family protein | - |
| DQL96_RS10175 | 2001011..2001331 | - | 321 | WP_000219666.1 | hypothetical protein | - |
| DQL96_RS10180 | 2001332..2001499 | - | 168 | WP_111689341.1 | DUF1270 domain-containing protein | - |
| DQL96_RS10185 | 2001512..2001721 | - | 210 | WP_000455728.1 | hypothetical protein | - |
| DQL96_RS10190 | 2001831..2002016 | - | 186 | Protein_1915 | phage repressor protein | - |
| DQL96_RS10195 | 2002073..2002675 | + | 603 | WP_033863222.1 | hypothetical protein | - |
| DQL96_RS10200 | 2002688..2002828 | - | 141 | WP_111689342.1 | hypothetical protein | - |
| DQL96_RS10205 | 2002812..2003594 | - | 783 | WP_111689343.1 | phage antirepressor KilAC domain-containing protein | - |
| DQL96_RS10210 | 2003596..2003781 | - | 186 | WP_000933365.1 | helix-turn-helix transcriptional regulator | - |
| DQL96_RS10215 | 2004227..2004709 | + | 483 | WP_000394410.1 | hypothetical protein | - |
| DQL96_RS10220 | 2004810..2004989 | - | 180 | WP_000438352.1 | hypothetical protein | - |
| DQL96_RS10225 | 2005008..2005238 | - | 231 | WP_103263741.1 | helix-turn-helix domain-containing protein | - |
| DQL96_RS10230 | 2005390..2005704 | + | 315 | WP_000333632.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DQL96_RS10235 | 2005717..2006178 | + | 462 | WP_000525015.1 | hypothetical protein | Toxin |
| DQL96_RS10240 | 2006196..2006699 | + | 504 | WP_000825944.1 | hypothetical protein | - |
| DQL96_RS10245 | 2006946..2007995 | + | 1050 | WP_000146088.1 | site-specific integrase | - |
| DQL96_RS10290 | 2009271..2009825 | - | 555 | WP_000132890.1 | alpha/beta hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1924308..2009825 | 85517 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18019.38 Da Isoelectric Point: 4.9167
>T292261 WP_000525015.1 NZ_LS483309:2005717-2006178 [Staphylococcus aureus]
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSEEYILKAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSEEYILKAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|