Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 434961..435502 Replicon chromosome
Accession NZ_LS483309
Organism Staphylococcus aureus strain NCTC9944

Toxin (Protein)


Gene name TscT Uniprot ID -
Locus tag DQL96_RS02085 Protein ID WP_111689292.1
Coordinates 435173..435502 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID A0A2B8BQK3
Locus tag DQL96_RS02080 Protein ID WP_001058490.1
Coordinates 434961..435170 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL96_RS02040 430023..430526 + 504 WP_000934798.1 single-stranded DNA-binding protein -
DQL96_RS02045 430578..430820 + 243 WP_000897044.1 30S ribosomal protein S18 -
DQL96_RS02050 431059..431958 - 900 WP_001797289.1 Abi family protein -
DQL96_RS02055 431960..433174 - 1215 WP_000270124.1 site-specific integrase -
DQL96_RS02060 433453..434148 - 696 WP_000700229.1 helix-turn-helix domain-containing protein -
DQL96_RS02065 434293..434505 + 213 WP_000608987.1 hypothetical protein -
DQL96_RS02070 434538..434810 + 273 WP_031903009.1 helix-turn-helix domain-containing protein -
DQL96_RS02075 434822..434968 + 147 WP_000784873.1 hypothetical protein -
DQL96_RS02080 434961..435170 + 210 WP_001058490.1 hypothetical protein Antitoxin
DQL96_RS02085 435173..435502 + 330 WP_111689292.1 DUF1474 family protein Toxin
DQL96_RS02090 435566..436435 + 870 WP_111689293.1 primase alpha helix C-terminal domain-containing protein -
DQL96_RS02095 436452..437921 + 1470 WP_053040304.1 virulence-associated E family protein -
DQL96_RS02100 438200..438562 + 363 WP_001039168.1 hypothetical protein -
DQL96_RS02105 438564..438848 + 285 WP_000998181.1 hypothetical protein -
DQL96_RS02110 438845..439486 + 642 WP_033863175.1 pathogenicity island protein -
DQL96_RS02115 440023..440364 + 342 WP_111689294.1 pathogenicity island protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(M) - 413718..516528 102810


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-92)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 13042.47 Da        Isoelectric Point: 4.5217

>T292258 WP_111689292.1 NZ_LS483309:435173-435502 [Staphylococcus aureus]
MNLEIKDLFSDLKLLKDRFEDLKDNHGWHFEELYPHEPNHVLNKDELIGEGFSYHERRIHNNQMFDLFHLYIEQFDNIIE
KFYEIEKASSDVSLATESDDAKNSIKVAE

Download         Length: 330 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8153.17 Da        Isoelectric Point: 4.3591

>AT292258 WP_001058490.1 NZ_LS483309:434961-435170 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVDGIEVVSEVSREKHLELIMKWCAQELKNNFQLGKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2B8BQK3

References