Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2087686..2088215 | Replicon | chromosome |
Accession | NZ_LS483308 | ||
Organism | Staphylococcus aureus strain NCTC13137 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DQL85_RS10790 | Protein ID | WP_000621175.1 |
Coordinates | 2087686..2088048 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DQL85_RS10795 | Protein ID | WP_000948331.1 |
Coordinates | 2088045..2088215 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL85_RS10765 | 2084664..2085434 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
DQL85_RS10770 | 2085409..2085888 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
DQL85_RS10775 | 2085890..2086216 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DQL85_RS10780 | 2086335..2087336 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DQL85_RS10790 | 2087686..2088048 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQL85_RS10795 | 2088045..2088215 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DQL85_RS10800 | 2088300..2089448 | - | 1149 | WP_001281154.1 | alanine racemase | - |
DQL85_RS10805 | 2089514..2089873 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
DQL85_RS10810 | 2089877..2090368 | - | 492 | WP_111743885.1 | PH domain-containing protein | - |
DQL85_RS10815 | 2090355..2091938 | - | 1584 | WP_001294620.1 | PH domain-containing protein | - |
DQL85_RS10820 | 2091931..2092410 | - | 480 | WP_001287079.1 | hypothetical protein | - |
DQL85_RS10825 | 2092619..2093179 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T292251 WP_000621175.1 NZ_LS483308:c2088048-2087686 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|