Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 825572..826049 Replicon chromosome
Accession NZ_LS483308
Organism Staphylococcus aureus strain NCTC13137

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DQL85_RS04100 Protein ID WP_000052076.1
Coordinates 825572..825760 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DQL85_RS04105 Protein ID WP_001059690.1
Coordinates 825789..826049 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL85_RS04070 821607..822083 + 477 WP_000824477.1 hypothetical protein -
DQL85_RS04075 822424..823110 + 687 WP_001641381.1 thermonuclease family protein -
DQL85_RS04080 823467..823667 + 201 WP_001059082.1 cold-shock protein -
DQL85_RS04085 824163..824381 - 219 WP_006189856.1 hypothetical protein -
DQL85_RS04090 824443..824727 - 285 WP_001004399.1 hypothetical protein -
DQL85_RS04095 824815..825384 - 570 WP_001106651.1 hypothetical protein -
DQL85_RS04100 825572..825760 - 189 WP_000052076.1 hypothetical protein Toxin
DQL85_RS04105 825789..826049 - 261 WP_001059690.1 hypothetical protein Antitoxin
DQL85_RS04110 826390..826593 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DQL85_RS04115 826590..826826 - 237 WP_000368687.1 hypothetical protein -
DQL85_RS04120 827050..827631 + 582 WP_001140693.1 phosphoglycerate mutase family protein -
DQL85_RS04125 827704..828321 - 618 WP_000255554.1 LysE/ArgO family amino acid transporter -
DQL85_RS04130 828475..828969 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
DQL85_RS04135 829368..829790 - 423 WP_006189864.1 organic hydroperoxide resistance protein -
DQL85_RS04140 829938..830654 + 717 WP_000150019.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T292244 WP_000052076.1 NZ_LS483308:c825760-825572 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT292244 WP_001059690.1 NZ_LS483308:c826049-825789 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References