Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 870407..870946 | Replicon | chromosome |
Accession | NZ_LS483305 | ||
Organism | Mammaliicoccus sciuri strain NCTC12103 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A418JBZ2 |
Locus tag | DQL71_RS04125 | Protein ID | WP_048540867.1 |
Coordinates | 870575..870946 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | DQL71_RS04120 | Protein ID | WP_048540868.1 |
Coordinates | 870407..870574 (+) | Length | 56 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL71_RS04095 | 866289..866768 | + | 480 | WP_048540877.1 | PH domain-containing protein | - |
DQL71_RS04100 | 866758..868278 | + | 1521 | WP_048540875.1 | PH domain-containing protein | - |
DQL71_RS04105 | 868268..868732 | + | 465 | WP_048540873.1 | PH domain-containing protein | - |
DQL71_RS04110 | 868764..869126 | + | 363 | WP_048540871.1 | holo-ACP synthase | - |
DQL71_RS04115 | 869174..870322 | + | 1149 | WP_048540869.1 | alanine racemase | - |
DQL71_RS04120 | 870407..870574 | + | 168 | WP_048540868.1 | hypothetical protein | Antitoxin |
DQL71_RS04125 | 870575..870946 | + | 372 | WP_048540867.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DQL71_RS04130 | 871043..872047 | + | 1005 | WP_048540866.1 | PP2C family protein-serine/threonine phosphatase | - |
DQL71_RS04135 | 872152..872475 | + | 324 | WP_025904513.1 | anti-sigma factor antagonist | - |
DQL71_RS04140 | 872480..872956 | + | 477 | WP_025904514.1 | anti-sigma B factor RsbW | - |
DQL71_RS04145 | 872931..873701 | + | 771 | WP_037589755.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13653.83 Da Isoelectric Point: 9.9193
>T292241 WP_048540867.1 NZ_LS483305:870575-870946 [Mammaliicoccus sciuri]
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDIAIAISLNLTLQQKFDTLGNT
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDIAIAISLNLTLQQKFDTLGNT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|