Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 978448..979221 | Replicon | chromosome |
Accession | NZ_LS483304 | ||
Organism | Staphylococcus hyicus strain NCTC10350 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | DQL55_RS11945 | Protein ID | WP_167693803.1 |
Coordinates | 979066..979221 (+) | Length | 52 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | A0A0A8HNH4 |
Locus tag | DQL55_RS04605 | Protein ID | WP_039644857.1 |
Coordinates | 978448..979047 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL55_RS04585 | 974757..975479 | + | 723 | WP_039644852.1 | amino acid ABC transporter ATP-binding protein | - |
DQL55_RS04590 | 975645..976772 | + | 1128 | WP_039644853.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DQL55_RS04595 | 976775..977245 | + | 471 | WP_039644854.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DQL55_RS04600 | 977261..978430 | + | 1170 | WP_039644856.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
DQL55_RS04605 | 978448..979047 | + | 600 | WP_039644857.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DQL55_RS11945 | 979066..979221 | + | 156 | WP_167693803.1 | hypothetical protein | Toxin |
DQL55_RS04610 | 979377..979781 | + | 405 | WP_039644859.1 | hypothetical protein | - |
DQL55_RS04615 | 979939..981324 | + | 1386 | WP_039644862.1 | class II fumarate hydratase | - |
DQL55_RS04620 | 981346..982872 | + | 1527 | WP_039644866.1 | exopolyphosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5989.31 Da Isoelectric Point: 3.9940
>T292239 WP_167693803.1 NZ_LS483304:979066-979221 [Staphylococcus hyicus]
MSEEKHIEHENEMVDNFDDLVQLGKEMEQISETNDQDKLNQSHDSEGRSNQ
MSEEKHIEHENEMVDNFDDLVQLGKEMEQISETNDQDKLNQSHDSEGRSNQ
Download Length: 156 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22363.41 Da Isoelectric Point: 6.0248
>AT292239 WP_039644857.1 NZ_LS483304:978448-979047 [Staphylococcus hyicus]
MAMNFKVFKDKDTAAIYAADIIRKQFNNNPTTIAGFHLNEEAAPVLDYLKRNVDDHAVDFSQIHILDYDKQTSYFKALGV
PEKQIHEIPEEDEVEKFIERKAKTKDNKGKLTLQVVSINNKGEFGIPVTNGLKPAREIFVVVTGSEKADVIKKLYEDNGN
TSFIPSSLKAHRMVNVILDEAAAQGLPDDVRAYFTSLYA
MAMNFKVFKDKDTAAIYAADIIRKQFNNNPTTIAGFHLNEEAAPVLDYLKRNVDDHAVDFSQIHILDYDKQTSYFKALGV
PEKQIHEIPEEDEVEKFIERKAKTKDNKGKLTLQVVSINNKGEFGIPVTNGLKPAREIFVVVTGSEKADVIKKLYEDNGN
TSFIPSSLKAHRMVNVILDEAAAQGLPDDVRAYFTSLYA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|